General Information

  • ID:  hor000619
  • Uniprot ID:  P12764
  • Protein name:  Allatostatin-10
  • Gene name:  NA
  • Organism:  Diploptera punctata (Pacific beetle cockroach)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  Brain, subesophageal ganglion and corpus allatum.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Diploptera (genus), Diplopterinae (subfamily), Blaberidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PVNSGRSSGSRFNFGL
  • Length:  16(217-232)
  • Propeptide:  MSGPRTCFCLPSALVLVLLSLSTSALGTAPEPSGVHEESPAGGGTDLLPHPEDLSASDNPDLEFVKRLYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSKMYGFGLGKRDGRMYSFGLGKRDYDYYGEEDEDDQQAIGDEDIEESDVGDLMDKRDRLYSFGLGKRARPYSFGLGKRAPSGAQRLYGFGLGKRGGSLYSFGLGKRGDGRLYAFGLGKRPVNSGRSSGSRFNFGLGKRSDDIDFRELEEKFAEDKRYP
  • Signal peptide:  MSGPRTCFCLPSALVLVLLSLSTSALG
  • Modification:  T16 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide inhibitors of juvenile hormone synthesis and gut muscle contraction.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P12764-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000619_AF2.pdbhor000619_ESM.pdb

Physical Information

Mass: 194953 Formula: C72H112N24O23
Absent amino acids: ACDEHIKMQTWY Common amino acids: S
pI: 12.5 Basic residues: 2
Polar residues: 9 Hydrophobic residues: 4
Hydrophobicity: -52.5 Boman Index: -3898
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 42.5
Instability Index: 6299.38 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8415611
  • Title:  Molecular Cloning of the Gene for the Allatostatin Family of Neuropeptides From the Cockroach Diploptera Punctata